Experiment :
partial-lagoon

Structure Complexes Generated

9

Combined Score

-149.83 ±8.716

Interface RMSD

1.039 ±0.609

DockQ Score

0.8 ±0.117

Docking Performance Distribution
Heavy Chain Sequence
QVGLVQSGPEVKTPGESVKISCTAGGYSFSSGLYWIDWVRERHGQGLEWMGMIHPSTSENTKYNPSFQSRVTISVNNSTNTAKEELSSLKAEDTATYLAARSAAVDVYTRGAYGKADRFEAWGQGALATVSS
Light Chain Sequence
ELVLTQSPLSTSVSPGERATLSCRASQSLVYGNGYNNLAAVTRQMPAEATRLLISGGSTRATGVGSRLSGSGSGTDYTLTINSQTKQLQSEDFAAYYAMRYNNWPTRLIKQTFGGGTKLEIKDFP
Best-Scoring Complex: mdscoring_2.pdb

3Dmol.js failed to load for some reason. Please check your browser console for error messages.

Individual Performance
model md5 caprieval_rank score irmsd fnat lrmsd ilrmsd dockq cluster-id cluster-ranking model-cluster-ranking air angles bonds bsa cdih coup dani desolv dihe elec improper rdcs rg total vdw vean xpcs
Loading ITables v2.3.0 from the internet... (need help?)
FrankIES : Scalable, AI-Based Antibody Design Against 2025 H5N1 Avian Influenza Isolates

FrankIES (Frankie Immune Engineering Suite) is a computational pipeline for antibody engineering that integrates multiple advanced tools:

  • Diffusion: EvoDiff v1.1.0 (Docker container: cford38/evodiff:v1.1.0)
  • Folding: ESM
  • Docking: HADDOCK3 (Docker container: cford38/haddock:3)

The pipeline automates the complex process of antibody design, folding, docking, and evaluation, providing comprehensive results visualization through this interactive report.

Host System Information

Operating System: Ubuntu 22.04.5 LTS

CPU: AMD Ryzen 7 7700X 8-Core Processor

Cores: 8 physical / 16 logical

Memory: 61.89 GB

GPUs:

  • NVIDIA GeForce RTX 5090 (32607 MiB)

GPU Driver: NVIDIA Driver 575.51.02